The domain within your query sequence starts at position 14 and ends at position 132; the E-value for the Rieske_2 domain shown below is 1.4e-14.

KYTSVCVGREEDIRKSERMTAVVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGEIEDFN
GQSCIVCPWHKYKITLATGEGLYQSINPKDPSAKPKWCSKGVKQRIHTVKVDNGNIYVT

Rieske_2

Rieske_2
PFAM accession number:PF13806
Interpro abstract (IPR012748):

This entry describes NirD, the small subunit of nitrite reductase [NAD(P)H] (the assimilatory nitrite reductase), which associates with NirB, the large subunit (IPR012744). In a few bacteria such as Klebsiella pneumoniae and in fungi, the two regions are fused.

GO process:nitrate assimilation (GO:0042128), oxidation-reduction process (GO:0055114)
GO function:nitrite reductase [NAD(P)H] activity (GO:0008942)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rieske_2