The domain within your query sequence starts at position 170 and ends at position 372; the E-value for the RimK domain shown below is 5.6e-7.

MGDKIESKLLAKRAKVNTIPGFDGVVKDADEAVRIAREIGYPVMIKASAGGGGKGMRIAW
DDEETRDGFRFSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLGDKHGNALWLNERECSIQ
RRNQKVVEEAPSIFLDPETRQAMGEQAVALAKAVKYSSAGTVEFLVDSQKNFYFLEMNTR
LQVEHPVTECITGLDLVQEMILV

RimK

RimK
PFAM accession number:PF08443
Interpro abstract (IPR013651):

This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK [(PUBMED:9416615)]. It has an unusual nucleotide-binding fold referred to as palmate, or ATP-grasp fold. This domain is found in a number of enzymes of known structure as well as in urea amidolyase, tubulin-tyrosine ligase, and three enzymes of purine biosynthesis.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RimK