The domain within your query sequence starts at position 9 and ends at position 91; the E-value for the Rio2_N domain shown below is 9.5e-36.

LRYMSRDDFRVLTAVEMGMKNHEIVPCSLIASIASLKHGGCNKILRELVKHKLIAWERTK
TVQGYRLTNAGYDYLALKTLSSR

Rio2_N

Rio2_N
PFAM accession number:PF09202
Interpro abstract (IPR015285):

This N-terminal domain is found in RIO2 kinases, and is structurally homologous to the winged helix (wHTH) domain. It adopts a structure consisting of four alpha helices followed by two beta strands and a fifth alpha helix. The domain confers DNA binding properties to the protein, as per other winged helix domains [(PUBMED:15341724)].

GO process:protein phosphorylation (GO:0006468)
GO function:ATP binding (GO:0005524), protein serine/threonine kinase activity (GO:0004674)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rio2_N