The domain within your query sequence starts at position 33 and ends at position 118; the E-value for the Ripply domain shown below is 2.3e-39.

FWRPWVRTPGEKEKRTGPRAAEALPSGPGMAEASGKLLQYQHPVRLFWPKSKCYDYLYQE
AETLLKNFPIQATISFYEDSDSEDEI

Ripply

Ripply
PFAM accession number:PF14998
Interpro abstract (IPR028127):

The precise function of this family is not clear, but it is thought to play a role in somitogenesis, development and transcriptional repression [(PUBMED:19247927)]. This family contains two conserved sequence motifs: WRPW and FPVQATI. The WRPW motif is thought to be required for binding to tle/groucho proteins [(PUBMED:16586348)]. Ripply2.2 is also known as Bowline and is an associate protein of the transcriptional co-repressor XGrg-4 [(PUBMED:17577580)]. Ripply3 is also known as Down Syndrome Critical Region Protein 6 homologue [(PUBMED:10814524)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ripply