The domain within your query sequence starts at position 10 and ends at position 186; the E-value for the RmlD_sub_bind domain shown below is 3.7e-10.

LVYLVTGGCGFLGEHIVRMLLEREPRLRELRVFDLHLSSWLEELKAGPVQVTAIQGDVTQ
AHEVAAAMSGSHVVIHTAGLVDVFGKASPKTIHKVNVQGTQNVIDACVQTGTQYLVYTSS
MEVVGPNIKGHPFYRGNEDTPYEAVHSHPYPCSKALAEQLVLEANGRKAMLLGCTYW

RmlD_sub_bind

RmlD_sub_bind
PFAM accession number:PF04321
Interpro abstract (IPR029903):

L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesised by four different enzymes. RmlD catalyses the final step of the dTDP-L-rhamnose synthesis. This entry represents the RmlD substrate binding domain, which is responsible for binding a sugar nucleotide [(PUBMED:12057193), (PUBMED:10802738)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RmlD_sub_bind