SMART: Pfam domain Rod

The domain within your query sequence starts at position 1579 and ends at position 2128; the E-value for the Rod_C domain shown below is 3.2e-256.

MITLPPAAHTRLPFHLILFGTAQNFWKILSSELSEESLPTLLLIAKLMKFSLDTLYVSTA
KHLFEKNLKPKLLKSAQARSSTLMSKEVDKLMQTLESYLLSIVNPEWAVAIAISLTQEVP
EGPFKMSSLKFCLYLAERWLQNIPPQDETCEKAKALQKKLCLQVRLSGTEAVLIAHKLND
QEYLRVIGKPAHLIVSLYEHPSISERLCTTSGKDYPDIHTAAKEIAEVNEVNLEKIWDML
LEKWLCPSTVPSEKASEFFELEEDEVLHRVVYLLQARPVDYCSRMLFVFATSATSTLGMR
QLTFAHKARALQCLLYLADKETIESLFKKPIKEMKSYLKCITFLASFETLNIPITYELFC
NSPKEGMIKGLWKNHSHEPMAVRLVAELCLEYKIYDLQLWNGLLQKLLGFNMIPYLRKVL
SCISSIHSLWQVPYFSKAWQRVIQIPLLSASCPLRPSQLADCCDSLVAILECPVSDDLDM
MGVAKQYVQLDLPAFALTCLTLMPHSEKRHQQIKNFLNSCDARIILQQIEEHMNTGQLAG
FSHQIGSLVL

Rod_C

PFAM accession number:	PF10493
Interpro abstract (IPR019527):	Rod, the Rough deal protein (also known as Kinetochore-associated protein 1) displays a dynamic intracellular staining pattern, localising first to kinetochores in pro-metaphase, but moving to kinetochore microtubules at metaphase. Early in anaphase the protein is once again restricted to the kinetochores, where it persists until the end of telophase. This behaviour is in all respects similar to that described for ZW10 [ (PUBMED:10523511) ], and indeed the two proteins function together, localisation of each depending upon the other [ (PUBMED:14711415) ]. These two proteins are found at the kinetochore in complex with a third, Zwilch, in both flies and humans. The C- terminus is the most conserved part of the protein. During pro-metaphase, the ZW10-Rod complex, dynein/dynactin, and Mad2 all accumulate on unattached kinetochores; microtubule capture leads to Mad2 depletion as it is carried off by dynein/dynactin; ZW10-Rod complex accumulation continues, replenishing kinetochore dynein. The continuing recruitment of the ZW10-Rod complex during metaphase may serve to maintain adequate dynein/dynactin complex on kinetochores for assisting chromatid movement during anaphase[ (PUBMED:14711415) ]. The ZW10-Rod complex acts as a bridge whose association with Zwint-1 links Mad1 and Mad2, components that are directly responsible for generating the diffusible 'wait anaphase' signal, to a structural, inner kinetochore complex containing Mis12 and KNL-1AF15q14, the last of which has been proved to be essential for kinetochore assembly in Caenorhabditis elegans. Removal of ZW10 or Rod inactivates the mitotic checkpoint [ (PUBMED:15824131) ].

PFAM accession number:

PF10493

Interpro abstract (IPR019527):

Rod, the Rough deal protein (also known as Kinetochore-associated protein 1) displays a dynamic intracellular staining pattern, localising first to kinetochores in pro-metaphase, but moving to kinetochore microtubules at metaphase. Early in anaphase the protein is once again restricted to the kinetochores, where it persists until the end of telophase. This behaviour is in all respects similar to that described for ZW10 [ (PUBMED:10523511) ], and indeed the two proteins function together, localisation of each depending upon the other [ (PUBMED:14711415) ]. These two proteins are found at the kinetochore in complex with a third, Zwilch, in both flies and humans. The C- terminus is the most conserved part of the protein. During pro-metaphase, the ZW10-Rod complex, dynein/dynactin, and Mad2 all accumulate on unattached kinetochores; microtubule capture leads to Mad2 depletion as it is carried off by dynein/dynactin; ZW10-Rod complex accumulation continues, replenishing kinetochore dynein. The continuing recruitment of the ZW10-Rod complex during metaphase may serve to maintain adequate dynein/dynactin complex on kinetochores for assisting chromatid movement during anaphase[ (PUBMED:14711415) ]. The ZW10-Rod complex acts as a bridge whose association with Zwint-1 links Mad1 and Mad2, components that are directly responsible for generating the diffusible 'wait anaphase' signal, to a structural, inner kinetochore complex containing Mis12 and KNL-1AF15q14, the last of which has been proved to be essential for kinetochore assembly in Caenorhabditis elegans. Removal of ZW10 or Rod inactivates the mitotic checkpoint [ (PUBMED:15824131) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rod_C