The domain within your query sequence starts at position 18 and ends at position 210; the E-value for the Rogdi_lz domain shown below is 1.2e-50.

EFRWLLHAEVHAVLRQLQDILKEASLRFTLPGPSTEGPAKQENFILGSCGTDQVKGTLTL
QGDALSQADVNLKMPRNNQLLHLAFREDKQWKLQQIQDARNHVSQAIYLLANRDESYQFK
TGAEVLKLMDAVMLQLTRARSRLTTPATLTLPEIAASGLTRMFAPTLPSDLLVNVYINLN
KLCLTVYHLFCDP

Rogdi_lz

Rogdi_lz
PFAM accession number:PF10259
Interpro abstract (IPR028241):

This is a family of conserved proteins which have been suggested as containing leucine-zipper domains. A leucine zipper domain is a region of 30 amino acids with leucines repeating every seven or eight residues; these proteins do have many such leucines. The representative protein in Drosophila comes from the gene ROGDI. This group includes Rav2 (RAVE complex subunit 2) from yeast. The RAVE complex is required for stable assembly of the vacuolar ATPase complex V-ATPase [ (PUBMED:11283612) (PUBMED:11844802) ].

Mutations in human ROGDI cause Kohlschütter-Tönz syndrome (KTS), which is an autosomal-recessive disease characterised by the combination of epilepsy, psychomotor regression, and amelogenesis imperfecta [ (PUBMED:22424600) (PUBMED:23086778) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rogdi_lz