SMART: Pfam domain Rotamase

The domain within your query sequence starts at position 61 and ends at position 165; the E-value for the Rotamase domain shown below is 1.4e-25.

HLLVKHSQSRRPSSWRQEKITRSKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKA
RGDLGPFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE

Rotamase

PFAM accession number:	PF00639
Interpro abstract (IPR000297):	Peptidyl-prolyl cis-trans isomerase ( EC 5.2.1.8 ) (PPIase or rotamase) is an enzyme that accelerates protein folding by catalysing the cis-trans isomerisation of proline imidic peptide bonds in oligopeptides [ (PUBMED:2186809) ]. Most characterised PPiases belong to two families, the cyclophilin-type and the the FKBP-type. A third family has been discovered [ (PUBMED:7925971) ]. So far, the only biochemically characterised member of this family is the Escherichia coli protein parvulin (gene ppiC), a small (92 residues) cytoplasmic enzyme that prefers amino acid residues with hydrophobic side chains like leucine and phenylalanine in the P1 position of the peptides substrates. This entry represents a conserved region that contains a serine which could play a role in the catalytic mechanism of these enzymes.
GO function:	peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

PFAM accession number:

PF00639

Interpro abstract (IPR000297):

Peptidyl-prolyl cis-trans isomerase ( EC 5.2.1.8 ) (PPIase or rotamase) is an enzyme that accelerates protein folding by catalysing the cis-trans isomerisation of proline imidic peptide bonds in oligopeptides [ (PUBMED:2186809) ]. Most characterised PPiases belong to two families, the cyclophilin-type and the the FKBP-type. A third family has been discovered [ (PUBMED:7925971) ]. So far, the only biochemically characterised member of this family is the Escherichia coli protein parvulin (gene ppiC), a small (92 residues) cytoplasmic enzyme that prefers amino acid residues with hydrophobic side chains like leucine and phenylalanine in the P1 position of the peptides substrates.

This entry represents a conserved region that contains a serine which could play a role in the catalytic mechanism of these enzymes.

GO function:

peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rotamase