The domain within your query sequence starts at position 32 and ends at position 133; the E-value for the Rpp20 domain shown below is 6.5e-22.
RRPNDIYVNMKTDFKAQLARCQKLLDGGTRGQNACTEIYIHGLGLAINRAINIALQLQAG SFGSLQVAANTSTVELVDELEPETDSREPLTRVRNNSAIHIR
Rpp20 |
![]() |
---|
PFAM accession number: | PF12328 |
---|---|
Interpro abstract (IPR014612): | This entry includes fission yeast ribonucleases P/MRP protein subunit Pop7 and its homologue, Rpp20, from animals. Pop7/Rpp20 is a component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. They are also a component of RNase MRP complex, which cleaves pre-rRNA sequences [ (PUBMED:15096576) (PUBMED:21450806) ]. |
GO process: | tRNA processing (GO:0008033) |
GO component: | nucleus (GO:0005634) |
GO function: | ribonuclease P activity (GO:0004526) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rpp20