The domain within your query sequence starts at position 1 and ends at position 48; the E-value for the Rpr2 domain shown below is 4.4e-12.

RQDPSVKRTLCRSCSSLLIPGLTCTQRQRRECCPRDICEAERDSAGQY

Rpr2

Rpr2
PFAM accession number:PF04032
Interpro abstract (IPR007175): This family contains a ribonuclease P subunit of human and yeast. Nnuclear RNase P cleaves tRNA precursors to generate mature 5' ends and facilitates turnover of nuclear RNAs [(PUBMED:11880623)]. Other members of the family include the probable archaeal homologues. This subunit possibly binds the precursor tRNA [(PUBMED:11497433)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rpr2