The domain within your query sequence starts at position 92 and ends at position 215; the E-value for the Rrp15p domain shown below is 3e-32.

WADAMAKILNKKTPKSKATILTKNKELEKEKEKLKQERLEKRKQLDKKREWEMLCRVKPD
VVKDKEAERNLQRIATRGVVQLFNAVQKHQRNVGEKVKEAGGSVRKRAKLMSTVSKKDFI
SVLR

Rrp15p

Rrp15p
PFAM accession number:PF07890
Interpro abstract (IPR012459):

Rrp15 is a constituent of pre-60S ribosomal particles. It is required for large subunit rRNA maturation, in particular processing of the 27S pre-rRNA at the A3 and B1 sites to yield 5.8S and 25S rRNA [(PUBMED:15769876)].

GO process:rRNA processing (GO:0006364)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rrp15p