The domain within your query sequence starts at position 61 and ends at position 505; the E-value for the RtcB domain shown below is 3.3e-143.

GFLPAMKQIGNVAALPGIVHRSIGLPDVHSGYGFAIGNMAAFDMNDPEAVVSPGGVGFDI
NCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVGSKGVIPMNAKDLEEALEMGVDWSL
REGYAWAEDKEHCEEYGRMLQADPNKVSPRAKKRGLPQLGTLGAGNHYAEIQVVDEIFNE
YAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKAMKRDKIIVNDRQLACARIAS
PEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDLDLHVIYDVSHNIAKVEQ
HVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMT
ETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTD
VVNTCHDAGISKKAIKLRPIAVIKG

RtcB

RtcB
PFAM accession number:PF01139
Interpro abstract (IPR001233):

RctB is a RNA ligase that mediates the joining of broken tRNA-like stem-loop structures in case of tRNA damage. It probably participates to tRNA restriction-repair by ligating broken tRNA-like stem-loop structures with 2',3'-cyclic phosphate and 5'-OH ends to form a splice junction with a 2'-OH, 3',5'-phosphodiester [(PUBMED:21224389)].

GO process:RNA processing (GO:0006396)
GO function:RNA ligase activity (GO:0008452)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RtcB