The domain within your query sequence starts at position 306 and ends at position 424; the E-value for the Rubis-subs-bind domain shown below is 5.5e-26.

LPAADKQLHRKITILKDHGFTGNLTFGWDGPSWRLLTALKLLCLEAERFTSWKKVLLGEV
ISDTNEKTSLGVAQKICSDVIEETHAVLRKVSDMKEGTVSLRSQLSLVEALRMEELRIL

Rubis-subs-bind

Rubis-subs-bind
PFAM accession number:PF09273
Interpro abstract (IPR015353):

This domain adopts a multihelical structure, with an irregular array of long and short alpha-helices. It allows binding of the protein to substrate, such as the N-terminal tails of histones H3 and H4 and the large subunit of the Rubisco holoenzyme complex [(PUBMED:12819771)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rubis-subs-bind