The domain within your query sequence starts at position 92 and ends at position 226; the E-value for the Runt domain shown below is 3.3e-83.

NRTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMA
GNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIK
VTVDGPREPRRHRQK

Runt

Runt
PFAM accession number:PF00853
Interpro abstract (IPR013524): The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia [(PUBMED:7651838)]. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene [(PUBMED:7651838)]. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.

In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.

The protein is a heterodimer of alpha- and beta-subunits. The alpha-subunit binds DNA as a monomer, and appears to have a role in the development of normal hematopoiesis. CBF is a nuclear protein expressed in numerous tissue types, except brain and heart; highest levels have been found to occur in thymus, bone marrow and peripheral blood.

This domain occurs towards the N terminus of the proteins in this entry.

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO function:DNA binding (GO:0003677), DNA binding transcription factor activity (GO:0003700)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Runt