The domain within your query sequence starts at position 327 and ends at position 420; the E-value for the RunxI domain shown below is 5.8e-41.
PGSSQSQSGPFQTSSTPYLYYGTSSASYQFPMVPGGDRSPSRMVPPCTTTSNGSTLLNPN LPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRP
RunxI |
 |
|---|
| PFAM accession number: | PF08504 |
|---|---|
| Interpro abstract (IPR013711): | This domain lies to the C terminus of Runx-related transcription factors and homologous proteins (AML, CBF-alpha, PEBP2). Its function might be to interact with functional cofactors [ (PUBMED:15713794) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RunxI