The domain within your query sequence starts at position 412 and ends at position 506; the E-value for the RunxI domain shown below is 2.7e-45.

PGSSQSQSGPFQTSSTPYLYYGTSSASYQFPMVPGGDRSPSRMVPPCTTTSNGSTLLNPN
LPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY

RunxI

RunxI
PFAM accession number:PF08504
Interpro abstract (IPR013711):

This domain lies to the C terminus of Runx-related transcription factors and homologous proteins (AML, CBF-alpha, PEBP2). Its function might be to interact with functional cofactors [(PUBMED:15713794)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RunxI