The domain within your query sequence starts at position 10 and ends at position 100; the E-value for the RuvB_N domain shown below is 3e-8.
RPAAARARNLPWVEKYRPQTLADLISHQDILSTIQKFISEDRLPHLLLYGPPGTGKTSTI LACAKQLYKDKEFGSMVLEVKETLSLHNSSD
RuvB_N |
---|
PFAM accession number: | PF05496 |
---|---|
Interpro abstract (IPR008824): | The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein [ (PUBMED:12423347) ]. This entry represents the N-terminal domain of the protein. |
GO process: | DNA recombination (GO:0006310), DNA repair (GO:0006281) |
GO function: | four-way junction helicase activity (GO:0009378) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RuvB_N