The domain within your query sequence starts at position 2819 and ends at position 2907; the E-value for the RyR domain shown below is 9.4e-34.

GYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNHPLLVPYDTLTA
KEKAKDREKAQDIFKFLQISGYVVSRGFK

RyR

RyR
PFAM accession number:PF02026
Interpro abstract (IPR003032): This domain is called RyR for Ryanodine receptor [(PUBMED:10664581)]. The domain is found in four copies in the ryanodine receptor. A single copy of this domain encodes an unknown protein from Bacteroides thetaiotamicron, and and suggests that the repeats in RyRs may have a prokaryotic origin [(PUBMED:22453942)]. The function of this domain is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RyR