The domain within your query sequence starts at position 18 and ends at position 116; the E-value for the S-AdoMet_synt_N domain shown below is 1.4e-44.

AFMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGEITSVAM
VDYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSP

S-AdoMet_synt_N

• PFAM accession number: PF00438
• Interpro abstract (IPR022628):

  S-adenosylmethionine synthetase (MAT, EC 2.5.1.6 ) is the enzyme that catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP [ (PUBMED:1696256) ]. AdoMet is an important methyl donor for transmethylation and is also the propylamino donor in polyamine biosynthesis.

  In bacteria there is a single isoform of AdoMet synthetase (gene metK), there are two in budding yeast (genes SAM1 and SAM2) and in mammals while in plants there is generally a multigene family.

  The sequence of AdoMet synthetase is highly conserved throughout isozymes and species. The active sites of both the Escherichia coli and rat liver MAT reside between two subunits, with contributions from side chains of residues from both subunits, resulting in a dimer as the minimal catalytic entity. The side chains that contribute to the ligand binding sites are conserved between the two proteins. In the structures of complexes with the E. coli enzyme, the phosphate groups have the same positions in the (PPi plus Pi) complex and the (ADP plus Pi) complex and are located at the bottom of a deep cavity with the adenosyl group nearer the entrance [ (PUBMED:1213535) ].

  The three domains of S-adenosylmethionine synthetase have the same alpha+beta fold. This entry represents the N-terminal domain of S-adenosylmethionine synthetase and is found in association with and .

• GO process: S-adenosylmethionine biosynthetic process (GO:0006556)
• GO function: methionine adenosyltransferase activity (GO:0004478)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry S-AdoMet_synt_N