The domain within your query sequence starts at position 55 and ends at position 112; the E-value for the S1-like domain shown below is 1.3e-29.

QRVFTGIVTSLHDYFGVVDEEVFFQLSVVKGRLPQLGEKVLVKAAYNPGQAVPWNAVK

S1-like

S1-like
PFAM accession number:PF14444
Interpro abstract (IPR025223):

This entry represents the S1-like RNA binding domain found in deleted in breast cancer 1 (DBC1) and its paralogue cell division cycle and apoptosis regulator protein 1 (CARP1) [(PUBMED:18418069)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry S1-like