The domain within your query sequence starts at position 189 and ends at position 327; the E-value for the S100PBPR domain shown below is 1.1e-77.
ISNHSEVPNRKNSGSHKSGCEVRIPVVSSSSNRHAFDKDSGEAKGERRLGKVIPVLQTRT RMFSQSELEKQKDIYLSKVIAHIEDPGDSNQGTLGELDALMDQVHMQHPDWQHPSDLTTR NYARFRQRPLQRYSLSQWV
S100PBPR |
---|
PFAM accession number: | PF15427 |
---|---|
Interpro abstract (IPR026097): | S100P-binding protein (S100PBP) interacts with S100P. S100P is a member of the S100 family of calcium-binding proteins and there have been several recent reports of its overexpression in pancreatic ductal adenocarcinoma (PDAC) [ (PUBMED:15632002) ]. |
GO function: | calcium-dependent protein binding (GO:0048306) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry S100PBPR