The domain within your query sequence starts at position 3 and ends at position 101; the E-value for the S10_plectin domain shown below is 1.2e-48.
MPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQF AWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRSRPET
S10_plectin |
---|
PFAM accession number: | PF03501 |
---|---|
Interpro abstract (IPR005326): | This presumed domain is found at the N terminus of some isoforms of the cytoskeletal muscle protein plectin as well as the ribosomal S10 protein. This domain may be involved in RNA binding. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry S10_plectin