The domain within your query sequence starts at position 1 and ends at position 70; the E-value for the S6OS1 domain shown below is 6.1e-21.
XARLFESKTFSEALDEKNKNTEKRKEFEERIFEKDEQVSNRSSQNSQLLLPCESQKFVRN MNSSEARVTD
S6OS1 |
---|
PFAM accession number: | PF15676 |
---|---|
Interpro abstract (IPR031380): | Protein SIX6OS1 (Six6 opposite strand transcript 1) may be involved in eye development through regulation of the SIX6 transcription factor [ (PUBMED:15703187) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry S6OS1