The domain within your query sequence starts at position 31 and ends at position 575; the E-value for the S6OS1 domain shown below is 1.1e-277.

IQRINKCLESIKENKANVSKLREAINKVDEDIAFHYKHSKEIKDSCSNWKPTCDVFHKHE
DYIKDQLTAYQETNEKDKKMYHDYICQYEDVLKQYQLKYSETRFSCKYYEKKKEHEEIKN
RVLACTEQLQLNETILMKFLVPAPFPSLTKWTLYVVNLRYRTQDILKRANNFTKRSFELE
KEADDMEIEINSLNKQMARLFESKTFSEALDEKNKNTEKRKEFEERIFEKDEQVSNRSSQ
NSQLLLPCESQKFVRNMNSSEARVTDKKEESSANQSKFVRSDVRQKENNPQIFNDSGMDS
NSKSSHIPAVKSSQGFMQFRLNQPNYNQRIEKEHIDAECGDKETVRQVRESKCSTQALYI
EHFGKSIENNSVEEERDENFPQTPETPSFLRTPEALKTPESMEKMQFPKSPFFEITKNAT
SEGHKQKDSPGFSFLMSYTSRSPGLNLFDSSVSDSEISSDQFNEHYSAVNLNPSSSQQGI
GNLFGKSEGEDAFTFSFSSDSSHTFGAGKDDFSFPFSFEQDPSTMTSSSSKDFSSSQNKT
QFMFF

S6OS1

S6OS1
PFAM accession number:PF15676
Interpro abstract (IPR031380): Protein SIX6OS1 (Six6 opposite strand transcript 1) may be involved in eye development through regulation of the SIX6 transcription factor [(PUBMED:15703187)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry S6OS1