The domain within your query sequence starts at position 40 and ends at position 116; the E-value for the S8_pro-domain domain shown below is 4.6e-27.

HWAVKIAGGFAEADRIASKYGFINVGQIGALKDYYHFYHSRTIKRSVLSSRGTHSFISME
PKVEWIQQQVVKKRTKR

S8_pro-domain

S8_pro-domain
PFAM accession number:PF16470
Interpro abstract (IPR032815):

This domain is the pro-domain of several peptidases belonging to family S8 [(PUBMED:12095256)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry S8_pro-domain