The domain within your query sequence starts at position 65 and ends at position 141; the E-value for the S8_pro-domain domain shown below is 3.1e-29.

HWAVQVLGGPGAADRVAAAHGYLNLGQIGNLDDYYHFYHSKTFKRSTLSSRGPHTFLRMD
PQVKWLQQQEVKRRVKR

S8_pro-domain

S8_pro-domain
PFAM accession number:PF16470
Interpro abstract (IPR032815):

This domain is the pro-domain of several peptidases belonging to family S8 [(PUBMED:12095256)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry S8_pro-domain