The domain within your query sequence starts at position 556 and ends at position 604; the E-value for the SAB domain shown below is 2.1e-29.

KAQDLDKTQDELMKHQTNISELKRTFLETSTETALTNEWEKRLSTSPVR

SAB

SAB
PFAM accession number:PF04382
Interpro abstract (IPR007477):

This presumed domain is found in proteins containing FERM domains IPR000299. This domain is found to bind to both spectrin and actin, hence the name SAB (Spectrin and Actin Binding) domain.

GO process:cortical actin cytoskeleton organization (GO:0030866)
GO component:cytoskeleton (GO:0005856)
GO function:cytoskeletal protein binding (GO:0008092)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SAB