The domain within your query sequence starts at position 567 and ends at position 762; the E-value for the SAC3_GANP domain shown below is 8.2e-66.

CAPDPSTVRPVAVLKKSLCMVKSHWKEKQDYAFACEQMKSIRQDLTVQGIRTEFTVEVYE
THARIALEKGDHEEFNQCQTQLKSLYAENLAGNVGEFTAYRILYYIFTKNSGDITTELAY
LTREMKADPCVAHALALRAAWALGNYHRFFRLYCHAPCMSGYLVDKFADRERKAALKAMI
KTYVALHSAAFCAVAL

SAC3_GANP

SAC3_GANP
PFAM accession number:PF03399
Interpro abstract (IPR005062):

This family contains one highly conserved negatively charged residue and one highly conserved positively charged residue that are probably important for the function of these proteins. The family includes the yeast nuclear export factor Sac3 [(PUBMED:12631707)], and mammalian GANP/MCM3-associated protein, which facilitates the nuclear localisation of MCM3, a protein that associates with chromatin in the G1 phase of the cell-cycle [(PUBMED:11526238)]. It also includes yeast Thp3 (THO-related protein 3), which may have a role in transcription elongation [(PUBMED:21149575)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SAC3_GANP