The domain within your query sequence starts at position 790 and ends at position 854; the E-value for the SAE2 domain shown below is 8.7e-13.

PHIEVVRKKEERRKLLGHTCKECEIYYADLPAEEREKKLASCSRHRFRYIPPNTPENFWE
VGFPS

SAE2

SAE2
PFAM accession number:PF08573
Interpro abstract (IPR013882):

This entry represents the C-terminal domain of the fission yeast Ctip protein. Proteins containing this domain include DNA endonuclease RBBP8 from animals and protein gamma response 1 (GR1) from Arabidopsis [(PUBMED:11023598)]. However, this entry does not include Sae2 from Saccharomyces cerevisiae.

RBBP8 is an endonuclease that cooperates with the MRE11-RAD50-NBN (MRN) complex in processing meiotic and mitotic double-strand breaks (DSBs) by ensuring both resection and intrachromosomal association of the broken ends [(PUBMED:17965729)]. Ctp1 is an endonuclease that cooperates with the MRN complex in processing meiotic and mitotic double-strand breaks by allowing the endonucleolytic removal of rec12 from the break sites and ensuring both resection and intrachromosomal association of the broken ends [(PUBMED:17936710)].

GO process:DNA repair (GO:0006281)
GO function:endonuclease activity (GO:0004519)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SAE2