The domain within your query sequence starts at position 6 and ends at position 131; the E-value for the SAGA-Tad1 domain shown below is 3.2e-18.
SELEAAKKNLSEALGDNVKQYWANLKLWFKQKISKEEFDLEAHRLLTQDNVHSHNDFLLA ILTRCQILVSTPEGAGSLPWTGGSAAKPGKPKGKKKLSSVRQKFDHRFQPQNPLSGAQQF VAKEPQ
SAGA-Tad1 |
![]() |
---|
PFAM accession number: | PF12767 |
---|---|
Interpro abstract (IPR024738): | The yeast Spt-Ada-Gcn5-Acetyl (SAGA) transferase complex is a multifunctional coactivator involved in multiple cellular processes [ (PUBMED:17694076) ], including regulation of transcription by RNA polymerase II [ (PUBMED:12898711) (PUBMED:15260971) ]. It is formed of five major modular subunits and shows a high degree of structural conservation to human TFTC and STAGA [ (PUBMED:11564863) ]. This entry represents Hfi1 (known as Transcriptional adapter 1, Tada1 in higher eukaryotes), one of the subunits that constitute the SAGA core. It also functions as a component of the SALSA and SLIK complexes. |
GO component: | SAGA-type complex (GO:0070461) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SAGA-Tad1