The domain within your query sequence starts at position 9 and ends at position 253; the E-value for the SAICAR_synt domain shown below is 4.8e-81.
IGKKLYEGKTKEVYELLDTPGRVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLL QEAGIKTAFTKKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVQEGYKFYPPKVEM FFKDDANNDPQWSEEQLIAAKFCFAGLVIGQTEVDIMSHATQAIFEILEKSWLPQDCTLV DMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKN FEWVA
SAICAR_synt |
---|
PFAM accession number: | PF01259 |
---|---|
Interpro abstract (IPR028923): | Phosphoribosylaminoimidazole-succinocarboxamide synthase ( EC 6.3.2.6 ) (SAICAR synthetase) catalyses the seventh step in the de novo purine biosynthetic pathway; the ATP-dependent conversion of 5'-phosphoribosyl-5-aminoimidazole-4-carboxylic acid and aspartic acid to SAICAR [ (PUBMED:1574589) ]. This domain can be found in SAICAR synthetases as a monofunctional protein from the bacteria (purC), fungi (ADE1) and plants (Pur7). In animals, this domain can be found in the N-terminal domain of a multifunctional enzyme (ADE2) possessing both the SAICAR synthetase and the phosphoribosylaminoimidazole carboxylase (AIR carboxylase) activity. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SAICAR_synt