The domain within your query sequence starts at position 1 and ends at position 36; the E-value for the SAM_PNT domain shown below is 1.3e-10.
MNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQR
SAM_PNT |
 |
|---|
| PFAM accession number: | PF02198 |
|---|---|
| Interpro abstract (IPR003118): | The highly conserved PNT (or Pointed) domain is found within a subset of the Ets transcription factors, including mammalian Ets-1, Ets-2, Erg, Fli-1, GABPalpha, and Tel, as well as Drosophila Pnt-P2 and Yan. The PNT domain is structurally related to the larger group of SAM domains through a common tertiary arrangement of four alpha-helices. A role in protein-protein association has been established for the PNT domain [ (PUBMED:10828014) (PUBMED:15351649) ]. |
| GO function: | sequence-specific DNA binding (GO:0043565) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SAM_PNT