The domain within your query sequence starts at position 336 and ends at position 425; the E-value for the SANTA domain shown below is 1.4e-27.

VHLQEWMIKVINNNTAICVEGKLVDMTDVYWHSNVIIERIKHNELRTLSGNIYILKGLID
SVSMKEAGYPCYLTRKFMFGFPHNWKEHID

SANTA

SANTA
PFAM accession number:PF09133
Interpro abstract (IPR015216):

The SANTA domain (SANT associated) is approximately 90 amino acids in length and is conserved in eukaryotes. It is sometimes found in association with the SANT domain (IPR001005, also known as the Myb-like DNA-binding domain) implying a putative function in regulating chromatin remodelling. Sequence analysis has showed that the SANTA domain is likely to form four central beta-sheets with three flanking alpha-helices. Many conserved hydrophobic residues are present which implies a possible role in protein-protein interactions.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SANTA