The domain within your query sequence starts at position 635 and ends at position 1040; the E-value for the SAP130_C domain shown below is 5.4e-224.

AQGSSPRPSILRKKPATDGMAVRKTLLPPQPPDVATPRVESSMRSASGSPRPAGAKPKSE
VHVSIATPVTVSLETISNQNAEQPTVAVPPTAQQPPPTIPSMIAAASPPSQPAIALSTIP
GAVPVTPPITTIAATPTLSAPVGGTPSTVLGPPVPEIKVKEEAEPVDITRPVSTVPPLAT
NTVSPSLALLASNLSMPPSDLPPGASPRKKPRKQQHVISTEEGDMMETNSTDDEKSAAKS
LLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYTQVKIQKE
KKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATD
DDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLN

SAP130_C

SAP130_C
PFAM accession number:PF16014
Interpro abstract (IPR031963):

SAP130 (Sin3-associated protein 130) is a component of the histone deacetylase-dependent co-repressor complex mSin3A that acts as a transcriptional repressor. It may function in the assembly and/or enzymatic activity of mSin3A or in mediating interactions between the complex and other regulatory complexes [(PUBMED:12724404)].

This entry represents the C-terminal domain of SAP130.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SAP130_C