The domain within your query sequence starts at position 35 and ends at position 104; the E-value for the SAP18 domain shown below is 4.2e-21.

PEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWCQGLKYKDQTKPLK
KSRVRMKRMS

SAP18

SAP18
PFAM accession number:PF06487
Interpro abstract (IPR010516):

This family consists of several eukaryotic Sin3 associated polypeptide p18 (SAP18) sequences. SAP18 is known to be a component of the Sin3-containing complex, which is responsible for the repression of transcription via the modification of histone polypeptides [ (PUBMED:9150135) ]. SAP18 is also present in the ASAP complex which is thought to be involved in the regulation of splicing during the execution of programmed cell death [ (PUBMED:12665594) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SAP18