The domain within your query sequence starts at position 38 and ends at position 156; the E-value for the SAP18 domain shown below is 2e-47.
PIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYP EARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAI
SAP18 |
---|
PFAM accession number: | PF06487 |
---|---|
Interpro abstract (IPR010516): | This family consists of several eukaryotic Sin3 associated polypeptide p18 (SAP18) sequences. SAP18 is known to be a component of the Sin3-containing complex, which is responsible for the repression of transcription via the modification of histone polypeptides [ (PUBMED:9150135) ]. SAP18 is also present in the ASAP complex which is thought to be involved in the regulation of splicing during the execution of programmed cell death [ (PUBMED:12665594) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SAP18