The domain within your query sequence starts at position 372 and ends at position 519; the E-value for the SAPS domain shown below is 1.8e-39.

ALTQELLVLDVPNTLLDLFFHYVFNNFLHAQVEVCVSAMLSSGPPPDSSSETPVPNPIVK
HLLQHCRLVERILASWEENDRVQSGGGPRKGYMGHLTRVANAVVQNAEQGPNAEQLGQLL
KELPEEQQQRWEAFVSGPLAETNKKNTV

SAPS

SAPS
PFAM accession number:PF04499
Interpro abstract (IPR007587):

The SAPS family consists of proteins that associate with the SIT4 phosphatase protein [(PUBMED:8649382)]. This association is required for SIT4's role in G1 cyclin transcription and for bud formation in yeast.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SAPS