SMART: Pfam domain SARA

The domain within your query sequence starts at position 52 and ends at position 92; the E-value for the SARA domain shown below is 1e-25.

SQSPNPNNPAEYCSTIPPLQQAQASGALSSPPPTVMVPVGV

SARA

PFAM accession number:	PF11409
Interpro abstract (IPR024608):	Smad proteins mediate transforming growth factor-beta (TGF-beta) signaling from the transmembrane serine-threonine receptor kinases to the nucleus. SARA (Smad anchor for receptor activation) recruits Smad2 to the TGF-beta receptors for phosphorylation [ (PUBMED:10615055) ]. This entry represents the Smad-binding domain (SBD) of SARA. This domain consists of a rigid coil, an alpha helix, and a beta strand, and interacts with Smad2 [ (PUBMED:10615055) ].

PFAM accession number:

PF11409

Interpro abstract (IPR024608):

Smad proteins mediate transforming growth factor-beta (TGF-beta) signaling from the transmembrane serine-threonine receptor kinases to the nucleus. SARA (Smad anchor for receptor activation) recruits Smad2 to the TGF-beta receptors for phosphorylation [ (PUBMED:10615055) ].

This entry represents the Smad-binding domain (SBD) of SARA. This domain consists of a rigid coil, an alpha helix, and a beta strand, and interacts with Smad2 [ (PUBMED:10615055) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SARA