The domain within your query sequence starts at position 48 and ends at position 363; the E-value for the SARAF domain shown below is 4.8e-98.

LLSLLLVAGPALGWNDPDRILLRDVKALTLYSDRYTTSRRLDPIPQLKCVGGTAGCEAYT
PRVIQCQNKGWDGYDVQWECKTDLDIAYKFGKTVVSCEGYESSEDQYVLRGSCGLEYNLD
YTELGLKKLKESGKHQGFSDYYHKLYSSDSCGFITIAVLFVLAFAVYKLFLSDGQGSPPP
YSEHPPYSEHSQRFASAAGAPPPGFKSEFTGPQNTGYGASSGFGSAFGGQGYGSSGPGFW
SGLGAGGLLGYLFGSNRAATPFSDSWYHPAYPPSHSGAWNSRAYSPLGGGAGSYCASSNA
DSRTRTASGYGGTRRR

SARAF

 SARAF
PFAM accession number:PF06682
Interpro abstract (IPR009567):

SARAF is an endoplasmic reticulum membrane resident protein that serves as a negative regulator of store-operated Ca2+ entry (SOCE) involved in protecting cells from Ca2+ overfilling. It is a single pass ER membrane protein whose systolic-facing domain is responsible for activity and whose luminary-facing domain carries out a regulatory function in conjunction with another membrane protein STIM, an ER single pass membrane protein that detects changes in ER Ca2+ levels through its EF-hand, conserved Ca2+ binding domain. STIM is the major target for SARAF regulation, and thus SARAF negatively regulates the SOCE entry of calcium into cells protecting them from overfilling [ (PUBMED:22464749) ].

GO process:regulation of store-operated calcium entry (GO:2001256)
GO component:integral component of endoplasmic reticulum membrane (GO:0030176)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SARAF