The domain within your query sequence starts at position 482 and ends at position 706; the E-value for the SBF2 domain shown below is 1.6e-107.

PAGPPVVSIMEKVITVFNSAQRLEVVRNCISFIFENKTLETEKTLPAALRALKGKAARQC
LTDELGLHVQQNRAILDHQQFDYIIRMMNCTLQDCSSLEEYNIAAALLPLTSAFYRKLAP
GVSQFAYTCVQDHPIWTNQQFWETTFYNAVQEQVRSLYLSAKDDNHIPHLKQKLPDGQHQ
EKTAMDLAAEQLRLWPTLSKSTQQELVQHEESTVFSQAIHFANLM

SBF2

SBF2
PFAM accession number:PF12335
Interpro abstract (IPR022096):

This domain family is found in eukaryotes, and is approximately 220 amino acids in length. It is found in association with. It is found is the middle region of SBF1 and SBF2, members of the myotubularin family. Myotubularin-related proteins have been suggested to work in phosphoinositide-mediated signalling events that may also convey control of myelination. Mutations of SBF2 are implicated in Charcot-Marie-Tooth disease [(PUBMED:12554688)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SBF2