SMART: Pfam domain SBF

The domain within your query sequence starts at position 10 and ends at position 324; the E-value for the SBF_like domain shown below is 1.9e-82.

EWFMVGIVVAIGAAKLEPSVGVNGGPLKPEITVSYIAVATIFFNSGLSLKTEELTSALVH
LRLHLFIQIFTLAFFPAAIWLFLQLLSVTSINEWLLKGLQTVGCMPPPVSSAVILTKAVG
GNEAAAIFNSAFGSFLGIVVTPVLLLLFLGSSSSVPFTSIFSQLFMTVVVPLVIGQIVRR
YIKDWLERKKPPFGVVSSSVLLMIIYTTFCDTFSNPNIDLDKFSLILILFIIVSVQLSFM
LLTFIFSTRNNSGFTPADTVAIIFCSTHKSLTLGIPMLKIVFAGHEHLSLISVPLLIYHP
AQILLGSVLVPTIKS

SBF_like

PFAM accession number:	PF13593
Interpro abstract (IPR016833):	This family includes sodium/bile acid cotransporter 7 [ (PUBMED:15932064) ] and other uncharacterised proteins with sodium bile acid cotransporter domain; they are found both in prokaryotes and eukaryotes.They are related to the human bile acid:sodium symporters, which are transmembrane proteins functioning in the liver in the uptake of bile acids from portal blood plasma, a process mediated by the co-transport of Na ⁺ [ (PUBMED:1961729) ].

PFAM accession number:

PF13593

Interpro abstract (IPR016833):

This family includes sodium/bile acid cotransporter 7 [ (PUBMED:15932064) ] and other uncharacterised proteins with sodium bile acid cotransporter domain; they are found both in prokaryotes and eukaryotes.They are related to the human bile acid:sodium symporters, which are transmembrane proteins functioning in the liver in the uptake of bile acids from portal blood plasma, a process mediated by the co-transport of Na ⁺ [ (PUBMED:1961729) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SBF_like