The domain within your query sequence starts at position 5 and ends at position 179; the E-value for the SCAMP domain shown below is 2.1e-69.

VNNFPPLPKFIPLKPCFYQDFEADIPPQHLSLTKRLYYLWMLNSVTLAVNLVGCLAWLIG
GGGATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAV
GIPGWGVCGWIATISFFGTNIGSAVVMLIPTVMFTVVAVFSFIALSMVHKFYRGS

SCAMP

SCAMP
PFAM accession number:PF04144
Interpro abstract (IPR007273):

In vertebrates, secretory carrier membrane proteins (SCAMPs) 1-3 constitute a family of putative membrane-trafficking proteins composed of cytoplasmic N-terminal sequences with NPF repeats, four central transmembrane regions (TMRs), and a cytoplasmic tail. SCAMPs probably function in endocytosis by recruiting EH-domain proteins to the N-terminal NPF repeats but may have additional functions mediated by their other sequences [ (PUBMED:11050114) ].

GO process:protein transport (GO:0015031)
GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SCAMP