The domain within your query sequence starts at position 1 and ends at position 67; the E-value for the SCIMP domain shown below is 6.7e-25.

MSWWRDNFWIILAMSIIFISLVLGLILYCVCRWQLRQGTGKLLSPQNRMEEMKKRCMRMF
LILHQAS

SCIMP

 SCIMP
PFAM accession number:PF15050
Interpro abstract (IPR028181):

SLP adapter and CSK-interacting membrane protein (SCIMP) is a lipid tetraspanin-associated transmembrane adapter/mediator involved in major histocompatibility complex class II (MHC-II) signaling transduction [ (PUBMED:21930792) ]. SCIMP is expressed in B cells and other professional antigen-presenting cells (APCs) and is localised in the immunological synapse. Upon MHC-II stimulation, phosphorylated SCIMP binds to the SLP65 and to the inhibitory kinase Csk. SLP65 binding initiates the downstream signaling cascades, while Csk binding functions as a negative regulatory loop [ (PUBMED:21930792) ].

GO component:tetraspanin-enriched microdomain (GO:0097197), integral component of membrane (GO:0016021), immunological synapse (GO:0001772)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SCIMP