The domain within your query sequence starts at position 93 and ends at position 182; the E-value for the SCP-1 domain shown below is 9.8e-53.
FEFENEKVSLKLEEEIQENKDLIKENNATIHWCNLLKETCARSAEKTNKYEYEREETRQV YVDLNSNIEKMILAFEELRVQAENARLEMH
SCP-1 |
---|
PFAM accession number: | PF05483 |
---|---|
Interpro abstract (IPR008827): | Synaptonemal complex protein 1 (SYCP1) is the major component of the transverse filaments of the synaptonemal complex. Synaptonemal complexes are structures that are formed between homologous chromosomes during meiotic prophase [ (PUBMED:1464329) ]. |
GO process: | synaptonemal complex assembly (GO:0007130) |
GO component: | synaptonemal complex (GO:0000795) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SCP-1