The domain within your query sequence starts at position 627 and ends at position 730; the E-value for the SCP2 domain shown below is 8.4e-27.

FGEIGRRLKSVGREVVKKANAVFEWHITKGGTVAAKWTIDLKSGSGEVYQGPAKGSADVT
IIISDEDFMEVVFGKLDPQKAFFSGRLKARGNIMLSQKLQMILK

SCP2

SCP2
PFAM accession number:PF02036
Interpro abstract (IPR003033):

This domain is involved in binding sterols, and is found in proteins such as SCP2. This domain has a 3-layer alpha/beta/alpha fold, composed of alpha/beta(3)/(crossover)/beta/(alpha)/beta.

The human sterol carrier protein 2 (SCP2), also known as nonspecific lipid transfer protein, is a basic protein that is believed to participate in the intracellular transport of cholesterol and various other lipids [(PUBMED:8243660)]. The Unc-24 protein of Caenorhabditis elegans contains a domain similar to part of two ion channel regulators (the erythrocyte integral membrane protein stomatin and the C. elegans neuronal protein MEC-2) juxtaposed to a domain similar to nonspecific lipid transfer protein (nsLTP; also called sterol carrier protein 2) [(PUBMED:8667025)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SCP2