The domain within your query sequence starts at position 55 and ends at position 519; the E-value for the SDF domain shown below is 8.5e-129.

FILLTVSAVIIGVSLAFALRPYQLSYRQIKYFSFPGELLMRMLQMLVLPLIVSSLVTGMA
SLDNKATGRMGMRAAVYYMVTTVIAVFIGILMVTIIHPGKGSKEGLHREGRIETVPTADA
FMDLVRNMFPPNLVEACFKQFKTQYSTRVVTRTIVRTDNGSELGASMSPTSSVENETSIL
ENVTRALGTLQEVISFEETVPVPGSANGINALGLVVFSVAFGLVIGGMKHKGRVLRDFFD
SLNEAIMRLVGIIIWYAPVGILFLIAGKILEMEDMAVLGGQLGMYTLTVIVGLFLHAGGV
LPLIYFLVTHRNPFPFIGGMLQALITAMGTSSSSATLPITFRCLEEGLGVDRRITRFVLP
VGATVNMDGTALYEALAAIFIAQVNNYELNLGQITTISITATAASVGAAGIPQAGLVTMV
IVLTSVGLPTEDITLIIAVDWFLDRLRTMTNVLGDSIGAAVIEHL

SDF

SDF
PFAM accession number:PF00375
Interpro abstract (IPR001991):

It has been shown [(PUBMED:8031825)] that integral membrane proteins that mediate the uptake of a wide variety of molecules with the concomitant uptake of sodium ions (sodium symporters) can be grouped, on the basis of sequence and functional similarities into a number of distinct families. One of these families [(PUBMED:1279699)] is known as the sodium:dicarboxylate symporter family (SDF).

Such re-uptake of neurotransmitters from the synapses, is thought to be an important mechanism for terminating their action, by removing these chemicals from the synaptic cleft, and transporting them into presynaptic nerve terminals, and surrounding neuroglia. this removal is also believed to prevent them accumulating to the point of reaching neurotoxic [(PUBMED:1448170), (PUBMED:1280334)].

The structure of these transporter proteins has been variously reported to contain from 8 to 10 transmembrane (TM) regions, although 10 now seems to be the accepted value.

Members of the family include: several mammalian excitatory amino acid transporters, and a number of bacterial transporters. They vary with regards to their dependence on transport of sodium, and other ions.

GO component:integral component of membrane (GO:0016021)
GO function:symporter activity (GO:0015293)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SDF