The domain within your query sequence starts at position 232 and ends at position 303; the E-value for the SEP domain shown below is 7.9e-20.
LKVYRNGIMMFDGPFRPFYDPSTQRCLRDILDGFFPSELQRLYPDGVPFKVSDLRNQIYP EDGLGQFPGEGR
SEP |
---|
PFAM accession number: | PF08059 |
---|---|
Interpro abstract (IPR012989): | The SEP (after shp1, eyc and p47) domain is an eukaryotic domain, which occurs frequently and mainly in single units. Almost all proteins containing a SEP domain are succeeded closely by a UBX domain. The function of the SEP domain is as yet unknown but it has been proposed to act as a reversible competitive inhibitor of the lysosomal cysteine protease cathepsin L [ (PUBMED:15029246) (PUBMED:15498563) ]. The sructure of the SEP domain comprises a beta-sheet composed of four strands, and two alpha-helices. One side of the beta-sheet faces alpha1 and alpha2. The longer helix alpha1 packs against the four-stranded beta-sheet, where as the shorter helix alpha2 is located at one edge of the globular structure formed by alpha1 and the four stranded beta sheet. A number of highly conserved hydrophobic residues are present in the SEP domain, which are predominantly buried and form the hydrophobic core [ (PUBMED:15029246) (PUBMED:15498563) ]. Some proteins known to contain a SEP domain are listed below:
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SEP