The domain within your query sequence starts at position 108 and ends at position 144; the E-value for the SERTA domain shown below is 1.5e-17.

ILYMSLEKLRFIDDPEVYLRRSVLINNLMKRIHGEIV

SERTA

SERTA
PFAM accession number:PF06031
Interpro abstract (IPR009263):

The SERTA (for SEI-1, RBT-1, and TARA) domain is a motif of ~47 residues corresponding to the largest conserved region among TRIP-Br (transcriptional regulator interacting with the PHD-bromodomain) proteins, an evolutionarily conserved family restricted to higher eukaryotes. In proteins of the TRIP-Br family, the SERTA domain is found in association with a cyclin A-binding domain and a PHD-bromo binding domain. The SERTA domain is also found in some other proteins with no conservation with TRIP-Br proteins outside of the SERTA motif. The cyclin-dependent kinase CDK4-interacting segment of TRIP-Br1 includes most of the SERTA domain [(PUBMED:11861561)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SERTA