The domain within your query sequence starts at position 108 and ends at position 144; the E-value for the SERTA domain shown below is 3.5e-20.
ILYMSLEKLRFIDDPEVYLRRSVLINNLMKRIHGEIV
SERTA |
---|
PFAM accession number: | PF06031 |
---|---|
Interpro abstract (IPR009263): | The SERTA (for SEI-1, RBT-1, and TARA) domain is a motif of ~47 residues corresponding to the largest conserved region among TRIP-Br (transcriptional regulator interacting with the PHD-bromodomain) proteins, an evolutionarily conserved family restricted to higher eukaryotes. In proteins of the TRIP-Br family, the SERTA domain is found in association with a cyclin A-binding domain and a PHD-bromo binding domain. The SERTA domain is also found in some other proteins with no conservation with TRIP-Br proteins outside of the SERTA motif. The cyclin-dependent kinase CDK4-interacting segment of TRIP-Br1 includes most of the SERTA domain [ (PUBMED:11861561) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SERTA