The domain within your query sequence starts at position 19 and ends at position 77; the E-value for the SFTA2 domain shown below is 1.5e-37.

AGPKVTLQVKLTETFQDKTSQNSSALDMLQKICLLLHLPSGTNVTLLHKGPPHYLTCRA

SFTA2

• PFAM accession number: PF15210
• Interpro abstract (IPR028198):

  This family of proteins are predicted to possess a signal peptide, indicating that they are secreted [ (PUBMED:15340161) ]. They are found in eukaryotes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SFTA2